PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 132aa    MW: 14960.3 Da    PI: 10.3576
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029794.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.88.7e-0758107554
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                 kr +r   N     rs +RK +++ eLe+kv+++e+e ++L  +l  l++
  Do029794.1  58 KRIKRILANQQLVARSKERKIKYTSELERKVQTMETEATTLSAQLTLLQN 107
                 77788888888889****************************99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-554125IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.50856107IPR004827Basic-leucine zipper domain
PfamPF077161.2E-556106IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-858107No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-758107No hitNo description
CDDcd147039.26E-1659106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MASRCRGRRR GRAQEERLHG RGDLAIRGRV CAAGCAPGLR QEGLAAEKLA EHALLDPKRI  60
KRILANQQLV ARSKERKIKY TSELERKVQT METEATTLSA QLTLLQNPGY PQKRKYHLVV  120
DVCETYDCFS QP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978752.18e-28PREDICTED: transcription factor VIP1-like
SwissprotQ9MA755e-26VIP1_ARATH; Transcription factor VIP1
TrEMBLK3ZJ529e-28K3ZJ52_SETIT; Uncharacterized protein
STRINGSi026605m3e-27(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1779279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.14e-13VIRE2-interacting protein 1